DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and decr-1.2

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_495805.1 Gene:decr-1.2 / 189090 WormBaseID:WBGene00012177 Length:309 Species:Caenorhabditis elegans


Alignment Length:252 Identity:73/252 - (28%)
Similarity:122/252 - (48%) Gaps:4/252 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINS 67
            :||.|:::|||..:|||...:...|.|...:.|..|.::||.:||..|....|........||..
 Worm    22 AFKGKLVLVTGGGTGIGKAIATTFAHLRATVVIAARRMEKLEQTARDITKITGGTCEPFQMDIKD 86

  Fly    68 ESDVQGIVSATLAKHGRI-DVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELI 131
            ...|.........|.|:: ::|||||....:.:.|..|...:..:::..::..:.:|..:....|
 Worm    87 PGMVSDAFDKIDMKFGKVPEILVNNAAGNFIMATELLSSNAYGTIIDIVLKGTFNVTTELGKRCI 151

  Fly   132 --KTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQR 194
              ||..:|.::::.......|.::...||||.|:..|:.:|.|.:..|:|.|:|:||.|.|: ..
 Worm   152 QNKTGASITSITAGYARAGAPFIVPSAVSKAGVETMTKSLATEWSKYGLRFNAVSPGPIPTK-GA 215

  Fly   195 RGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGR 251
            .|.|:........|..|..:..||.|..:|||..:||::||..||..|..:.:|||:
 Worm   216 WGRLNSGEMGDIAEKMKFLNPEGRVGSPEEVANLVAFISSDHMSFLNGAIIDLDGGQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 72/250 (29%)
NADB_Rossmann 4..254 CDD:304358 73/251 (29%)
decr-1.2NP_495805.1 TER_DECR_SDR_a 23..274 CDD:187627 73/251 (29%)
PRK07677 25..272 CDD:181077 70/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.