DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and F28H7.2

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_505742.1 Gene:F28H7.2 / 185096 WormBaseID:WBGene00009236 Length:284 Species:Caenorhabditis elegans


Alignment Length:274 Identity:103/274 - (37%)
Similarity:151/274 - (55%) Gaps:36/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAP---ALQVA 62
            |..|.|||.|:||:|:|||..|:.|||..|..:|:.|||.::|.|| :.|:...|.|   .|.|.
 Worm     1 MSRFTDKVAIITGSSNGIGQATARLLASEGAKVTVTGRNAERLEET-KNILLGAGVPEGNVLVVV 64

  Fly    63 ADINSESDVQGIVSATLAKHGRIDVLVNNAGI----LELGSIENTSLEQFDRVMNTNVRSLYQLT 123
            .||..||..:.::.:||.|.|:||:||||||.    .:..|..|.|::.:.:....||:|:.::|
 Worm    65 GDITQESVQENLIKSTLDKFGKIDILVNNAGAGIPDAQGKSGVNQSIDTYHKTFELNVQSVIEMT 129

  Fly   124 HLVTPELIKTKGNIVNVSSVNGIRSFPGVLA------YNVSKAAVDQFTRCVALELAPKGVRVNS 182
            ....|.|.||:|.|||:||:..     |..|      |:::|||:||:||..|::|.|:|:||||
 Worm   130 QKARPHLAKTQGEIVNISSIGA-----GPAAQVASPYYSIAKAALDQYTRTAAIDLVPEGIRVNS 189

  Fly   183 VNPGVIITELQR-RGGLDQEAYVKFLEHAKVTHALGRPGEV---------KEVAAAIAFLASDEA 237
            |:||.:.|.... ..||.:|....|.::      ||...|.         :::|..|||||...|
 Worm   190 VSPGAVSTGFSAVSRGLTEEKSKAFYDY------LGAQRECIPRGFCAVPEDIAKVIAFLADRNA 248

  Fly   238 S-FSTGISLPVDGG 250
            | :..|.::..|||
 Worm   249 SNYIIGQTIVADGG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 102/273 (37%)
NADB_Rossmann 4..254 CDD:304358 102/271 (38%)
F28H7.2NP_505742.1 fabG 3..262 CDD:235506 100/270 (37%)
NADB_Rossmann 4..266 CDD:304358 102/271 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45843
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.