Sequence 1: | NP_649563.1 | Gene: | CG12171 / 40690 | FlyBaseID: | FBgn0037354 | Length: | 257 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001355440.1 | Gene: | stdh-4 / 184934 | WormBaseID: | WBGene00006435 | Length: | 317 | Species: | Caenorhabditis elegans |
Alignment Length: | 204 | Identity: | 49/204 - (24%) |
---|---|---|---|
Similarity: | 90/204 - (44%) | Gaps: | 36/204 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 IVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESDVQ-- 72
Fly 73 -GIVSATLAKH----------GRID--VLVNNAGIL-----ELGSIENTSLEQFDRVMNTNVRSL 119
Fly 120 YQLTHLVTPELIKTK-GNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSV 183
Fly 184 NPGVIITEL 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12171 | NP_649563.1 | fabG | 2..251 | CDD:235975 | 49/204 (24%) |
NADB_Rossmann | 4..254 | CDD:304358 | 49/204 (24%) | ||
stdh-4 | NP_001355440.1 | 17beta-HSD1_like_SDR_c | 53..295 | CDD:187614 | 49/204 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D913128at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |