DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and stdh-4

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001355440.1 Gene:stdh-4 / 184934 WormBaseID:WBGene00006435 Length:317 Species:Caenorhabditis elegans


Alignment Length:204 Identity:49/204 - (24%)
Similarity:90/204 - (44%) Gaps:36/204 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESDVQ-- 72
            :||||:.|||...::.||:.|..:.::.|...||.:|.:||              :|..||::  
 Worm    57 VVTGATDGIGRSYALDLARRGFNIFLISRTKSKLVKTKKQI--------------LNKYSDIEVR 107

  Fly    73 -GIVSATLAKH----------GRID--VLVNNAGIL-----ELGSIENTSLEQFDRVMNTNVRSL 119
             .|...|...:          ..:|  :|:||.|:.     .|..:|. .::....|:|.|:..:
 Worm   108 YAICDFTRVSYEDYKRLLHSLNEVDIGILINNVGMCFDNPEVLHRVEG-GIDTLTNVINVNILPV 171

  Fly   120 YQLTHLVTPELIKTK-GNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSV 183
            ..||..:.|:::..| |.|||:.|..|.........|:.:|..::.||..:..|...:|:...::
 Worm   172 TLLTAGILPQMMARKSGIIVNIGSAAGSIHMAKWSVYSATKKYIEWFTSILQKEYENEGIICQTI 236

  Fly   184 NPGVIITEL 192
            .|.::.|.:
 Worm   237 TPLLVSTNM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 49/204 (24%)
NADB_Rossmann 4..254 CDD:304358 49/204 (24%)
stdh-4NP_001355440.1 17beta-HSD1_like_SDR_c 53..295 CDD:187614 49/204 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.