DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and C06B8.3

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_506855.2 Gene:C06B8.3 / 182298 WormBaseID:WBGene00007369 Length:162 Species:Caenorhabditis elegans


Alignment Length:148 Identity:54/148 - (36%)
Similarity:77/148 - (52%) Gaps:13/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 MNTNVRSLYQLTHLVTPELIKTKGNIVNVSSV-NGIRSFPGVLAYNVSKAAVDQFTRCVALELAP 175
            |..|:||:..|.......||||||.|:||||: :|......:..|.:|||.::.|||..|:.|..
 Worm     1 MQINMRSVITLVQKAKEHLIKTKGEIINVSSIASGPHGDSQMTYYGMSKADLNHFTRSSAISLIQ 65

  Fly   176 KGVRVNSVNPGVIITELQRRGGLDQEAYVKFLEHAKVTH-------ALGRPGEVKEVAAAIAFLA 233
            .|||||||:||..:|......|....|..|.::| ..:|       .:.|||::.::   |.|||
 Worm    66 HGVRVNSVSPGFTLTGFGDAMGFPPGALEKVIKH-YASHKECIPSGVVARPGDIAQI---ILFLA 126

  Fly   234 S-DEASFSTGISLPVDGG 250
            . ..:|:..|.|:..|||
 Worm   127 DRTMSSYIIGQSIIADGG 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 54/148 (36%)
NADB_Rossmann 4..254 CDD:304358 54/148 (36%)
C06B8.3NP_506855.2 NADB_Rossmann <1..148 CDD:304358 54/148 (36%)
FabG <1..144 CDD:223959 52/146 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.