DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and stdh-1

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_506449.1 Gene:stdh-1 / 182291 WormBaseID:WBGene00007363 Length:314 Species:Caenorhabditis elegans


Alignment Length:245 Identity:63/245 - (25%)
Similarity:105/245 - (42%) Gaps:56/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADIN-------- 66
            :||||:.|||...|..|||.|..:.||.|...||..|.::|        |:|..||.        
 Worm    51 VVTGATDGIGKSYSFELAKRGFNVYIVSRTQSKLEHTKKEI--------LEVHPDIEVRFATFDF 107

  Fly    67 ---SESDVQGIVSATLAKHGRIDVLVNNAGIL------------ELGSIENTSLEQFDRVMNTNV 116
               |.||.:.::|.  .....|.:|:||.|:.            .:.||.|.:      ::||..
 Worm   108 TNPSVSDYEKLLSK--LNEVSIGILINNVGMFFDYPEMLHKINGGIDSIANVT------IINTLP 164

  Fly   117 RSLYQLTHLVTPELIKTK-GNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRV 180
            .:|  |:..:.|:::..| |.|||:.||.|:.:......|:.:|..|:..|.|:..|...:|:..
 Worm   165 ATL--LSAGILPQMVPRKAGIIVNIGSVAGLATMAEWSVYSATKKYVEWITGCLQKEYGHQGIIF 227

  Fly   181 NSVNPGVIITELQRRGGL-----DQEAYVK----FLEHAK-----VTHAL 216
            .::.|.::.|::......     |.:.:.|    .:.||.     :||.:
 Worm   228 QAITPAMVATKMAGNPNTSFFTPDSDTFAKSALNTIGHASQTTGYITHQI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 63/245 (26%)
NADB_Rossmann 4..254 CDD:304358 63/245 (26%)
stdh-1NP_506449.1 17beta-HSD1_like_SDR_c 47..289 CDD:187614 63/245 (26%)
adh_short 49..242 CDD:278532 57/208 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.