DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and dhs-11

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_499346.2 Gene:dhs-11 / 176485 WormBaseID:WBGene00000974 Length:244 Species:Caenorhabditis elegans


Alignment Length:250 Identity:83/250 - (33%)
Similarity:122/250 - (48%) Gaps:19/250 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESDV 71
            |:.||||..||||.......|..|..|.:..........||..: ...|..|.::  |::....|
 Worm     5 KLAIVTGGGSGIGQAICKKFAASGARLIVADLKKSAAEATAGNL-PGNGHSAFEI--DVSDPEHV 66

  Fly    72 QGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTKG- 135
            ..:.....:......||||.|||.:..::...|..|:..|||.|:.|::.::.::..|.:.... 
 Worm    67 ARLQEFIKSSGESPSVLVNCAGITKDATLLKMSQNQWQDVMNVNLNSVFLMSQMIARESVAAGSP 131

  Fly   136 -NIVNVSSVNG-IRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVI---ITELQRR 195
             :||||||:.| |.:| |...|..:|:.|..||:..|.|||.|.:|||:|.||.|   :||....
 Worm   132 LSIVNVSSIVGKIGNF-GQTNYAATKSGVIGFTKSAARELATKNIRVNAVLPGFIRTPMTEAMPP 195

  Fly   196 GGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            ..||  |.|..:...::       ||.:|:|.|:.|||||.:|:.||.:|.|.||
 Worm   196 KVLD--AMVSMVPQRRL-------GETEEIANAVLFLASDMSSYVTGTTLEVTGG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 82/249 (33%)
NADB_Rossmann 4..254 CDD:304358 82/249 (33%)
dhs-11NP_499346.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.