DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and dhs-9

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_498146.1 Gene:dhs-9 / 175737 WormBaseID:WBGene00000973 Length:319 Species:Caenorhabditis elegans


Alignment Length:270 Identity:87/270 - (32%)
Similarity:122/270 - (45%) Gaps:59/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGR----------NLDKLNETAEQIVAAGGAP 57
            |...::.||||||.|||.|.::.|.:.|..:.|.||          .|..|..||::|...||..
 Worm     2 SLAGQIAIVTGASRGIGRGIALQLGEAGATVYITGRKPEESLNSKVGLSGLEATADEITKRGGKG 66

  Fly    58 ALQVAADINSESDVQGIVSATLAKH-GRIDVLVNNA--GILELGSIEN-------TSLEQFDRVM 112
            ..:.....|.| :|:........:| |::|:|||||  |:..:.  ||       |....:|.:.
 Worm    67 IARFVDHQNME-EVKNFFEVVEKEHQGQLDILVNNAYQGVTAIS--ENMGKPFYETDPYVWDTIN 128

  Fly   113 NTNVRSLYQLT----HLVTPELIKTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALEL 173
            |..:|:.|..|    .|:|   .:.||.||||||..|:|....| ||.|.|.|:|:.:...|:||
 Worm   129 NVGLRNHYFCTVYAARLMT---ARNKGLIVNVSSGGGLRYLFNV-AYGVGKQALDRMSADTAVEL 189

  Fly   174 APKGVRVNSVNPGVIITELQRRGGLDQEAYVKFLEHAKVTHALGRP-GEVK--EVAA-------- 227
            ..|.|.|.|:.||.:.|||..:...|:.               |:| .|:|  ||.|        
 Worm   190 RKKNVCVVSIWPGAVRTELVDKMFKDEN---------------GKPRPEIKNAEVFANGETVEYP 239

  Fly   228 --AIAFLASD 235
              |:..||||
 Worm   240 GRAVVSLASD 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 87/270 (32%)
NADB_Rossmann 4..254 CDD:304358 86/269 (32%)
dhs-9NP_498146.1 PRK08303 1..279 CDD:236229 87/270 (32%)
NADB_Rossmann 3..276 CDD:304358 86/269 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2936
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.