DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and DECR1

DIOPT Version :10

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001350.1 Gene:DECR1 / 1666 HGNCID:2753 Length:335 Species:Homo sapiens


Alignment Length:195 Identity:36/195 - (18%)
Similarity:64/195 - (32%) Gaps:64/195 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 SQPTASTTR---------KPK-VVSIGATIVDFEAITSEDVKDD--------GGSYNGQVVQRMG 369
            |:|.....|         ||. |:.:....|||...|.:...|.        .|.:..:|:||..
Human    80 SEPAGGPRREDIVDTMVFKPSDVLLVHFRNVDFNYATKDKFTDSAIAMNSKVNGEHKEKVLQRWE 144

  Fly   370 GVARNHADALARLGCDSVFISAIGDDNNGHFFRQN--SHKIDINRVKIISNKPTCTYLAVNVKGN 432
            |                      ||.|:..:..::  |:..|.|.:...:.:             
Human   145 G----------------------GDSNSDDYDLESDMSNGWDPNEMFKFNEE------------- 174

  Fly   433 VKYGI-VTCEPLLSVITPSLVESNEDALESSDFILLDSNLSVPVMARVLEIAKKHDKQVWLEPTD 496
             .||: .|.:..||..|..|.:.|.:.....:       |....:||.:|.:.::..::.:|..|
Human   175 -NYGVKTTYDSSLSSYTVPLEKDNSEEFRQRE-------LRAAQLAREIESSPQYRLRIAMENDD 231

  Fly   497  496
            Human   232  231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 Rossmann-fold NAD(P)(+)-binding proteins 4..254 CDD:473865
DECR1NP_001350.1 TER_DECR_SDR_a 57..303 CDD:187627 36/195 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.