DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and Cbr2

DIOPT Version :10

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_031647.1 Gene:Cbr2 / 12409 MGIID:107200 Length:244 Species:Mus musculus


Alignment Length:132 Identity:27/132 - (20%)
Similarity:49/132 - (37%) Gaps:31/132 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 MATNIALLENNASIA------------GRLAAKLCDRRPLTISQSQPTASTTRKPKVVSIGATIV 343
            :...|.|.:.||.:|            .....::.|.|||:: ..||...:..:.|      |::
Mouse   187 LVATIFLNKTNARVALPVLWEFLECYPSAAVTRVSDWRPLSV-LLQPLGLSQLRAK------TLI 244

  Fly   344 DFEAITSEDVKDDGGSYNGQVVQRMGGVARNHADALARLGCDSVFISAIGDD---NNGHFFRQNS 405
            .|        .|:..|.:.|....:.|:.:...|:. |:.|...:.....||   |:.|.:...:
Mouse   245 RF--------SDEYISKSWQYPIELHGIGKYGNDSY-RIFCVDEWREVTPDDHKLNDYHAWLWKN 300

  Fly   406 HK 407
            ||
Mouse   301 HK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 Rossmann-fold NAD(P)(+)-binding proteins 4..254 CDD:473865
Cbr2NP_031647.1 XR_like_SDR_c 1..244 CDD:187609 13/63 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.