DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and DHRS1

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001129522.1 Gene:DHRS1 / 115817 HGNCID:16445 Length:313 Species:Homo sapiens


Alignment Length:260 Identity:80/260 - (30%)
Similarity:118/260 - (45%) Gaps:43/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESDV 71
            :|.:|||||.|||.|.::.|.|.|..:.|.||:||.|...|::..:.|| ..:.|..|.:.||:|
Human     8 QVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGG-QCVPVVCDSSQESEV 71

  Fly    72 QGIV-SATLAKHGRIDVLVNN--AGILELGSIEN-----TSLEQFDRVMNTNVRSLYQLT----H 124
            :.:. .....:.||:||||||  ||:..:.:..|     |....:|.:.|..:|..|..:    .
Human    72 RSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGAR 136

  Fly   125 LVTPELIKTKGNIVNVSSVNGIRSFPGVL------AYNVSKAAVDQFTRCVALELAPKGVRVNSV 183
            |:.|   ..:|.||.:||       ||.|      .|.|.|||.|:.....|.||...||...|:
Human   137 LMVP---AGQGLIVVISS-------PGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSL 191

  Fly   184 NPGVIITELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVD 248
            .||::.|||.:             ||......|..| .:|:..:|.:...:.|.|....::|..|
Human   192 WPGIVQTELLK-------------EHMAKEEVLQDP-VLKQFKSAFSSAETTELSGKCVVALATD 242

  Fly   249  248
            Human   243  242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 80/260 (31%)
NADB_Rossmann 4..254 CDD:304358 80/260 (31%)
DHRS1NP_001129522.1 PRK08303 1..271 CDD:236229 80/260 (31%)
DHRS1-like_SDR_c 5..271 CDD:187664 80/260 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2936
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.