Sequence 1: | NP_649563.1 | Gene: | CG12171 / 40690 | FlyBaseID: | FBgn0037354 | Length: | 257 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_766635.1 | Gene: | Cbr3 / 109857 | MGIID: | 1309992 | Length: | 277 | Species: | Mus musculus |
Alignment Length: | 240 | Identity: | 59/240 - (24%) |
---|---|---|---|
Similarity: | 97/240 - (40%) | Gaps: | 54/240 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 KVIIVTGASSGIG-AGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESD 70
Fly 71 VQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELI---K 132
Fly 133 TKGNIVNVSSVNGIRSFPGV-----------------------------------------LAYN 156
Fly 157 VSKAAVDQFTRCVALELAPK----GVRVNSVNPGVIITELQRRGG 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12171 | NP_649563.1 | fabG | 2..251 | CDD:235975 | 59/240 (25%) |
NADB_Rossmann | 4..254 | CDD:304358 | 59/240 (25%) | ||
Cbr3 | NP_766635.1 | carb_red_PTCR-like_SDR_c | 6..277 | CDD:187585 | 59/240 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167830560 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |