DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and XB5863530

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_002941866.3 Gene:XB5863530 / 100497556 XenbaseID:XB-GENE-5863531 Length:346 Species:Xenopus tropicalis


Alignment Length:206 Identity:67/206 - (32%)
Similarity:108/206 - (52%) Gaps:17/206 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESDVQGI 74
            :||||:.|||...:..||:.|..:.::.|:.:||...||.|....|.....:.||...:..:...
 Frog    82 VVTGATDGIGKSYAEELARRGFDIVLISRSPEKLQRVAEGIEQKSGRKTKIIQADYTGDVGIYTP 146

  Fly    75 VSATLAKHGRIDVLVNNAGI---------LELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPEL 130
            :...| |...|.|||||.|:         |::.:::    |:...|:|.|:.|:.|:|.:|.|.:
 Frog   147 IEEGL-KGLDIGVLVNNVGMAYSNEPVRFLDVPNVK----ERLTNVINCNIVSVLQMTRIVLPGM 206

  Fly   131 I-KTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQR 194
            : |.||.|:|:||..|...||.|..|:.:|..||.|:||:..|.:|:|:.|.||.|.::.|.:  
 Frog   207 LKKKKGLIINISSEAGSHPFPMVAVYSSTKVFVDYFSRCLHTEYSPQGITVQSVMPLLVSTNM-- 269

  Fly   195 RGGLDQEAYVK 205
            ..|:....:||
 Frog   270 TFGIKSNIFVK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 67/206 (33%)
NADB_Rossmann 4..254 CDD:304358 67/206 (33%)
XB5863530XP_002941866.3 17beta-HSD1_like_SDR_c 78..315 CDD:187614 67/206 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.