DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LYZ and CG11159

DIOPT Version :10

Sequence 1:NP_000230.1 Gene:LYZ / 4069 HGNCID:6740 Length:148 Species:Homo sapiens
Sequence 2:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster


Alignment Length:134 Identity:48/134 - (35%)
Similarity:76/134 - (56%) Gaps:9/134 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     5 IVLGLVLLSV-TVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDR 68
            :||.|:|||. ..:.|:..||:||:.|.|   ..:....|:||:||.:.|||.:| :.:....::
  Fly    13 LVLNLLLLSQWETESKLLTRCQLAKELLR---HDFPRSYLSNWVCLVEAESGRST-SKSMQLPNQ 73

Human    69 STDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNR 133
            |..||:|||||:.||..|:..|   .|::.|...|.|.|:|...||.::. :..|.:||..|.::
  Fly    74 SVSYGLFQINSKNWCRKGRRGG---ICNIKCEEFLNDEISDDSRCAMQIF-NRHGFQAWPGWMSK 134

Human   134 CQNR 137
            |:.|
  Fly   135 CRGR 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LYZNP_000230.1 LYZ_C 19..146 CDD:340383 42/119 (35%)
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 42/119 (35%)

Return to query results.
Submit another query.