DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LYZ and CG16756

DIOPT Version :10

Sequence 1:NP_000230.1 Gene:LYZ / 4069 HGNCID:6740 Length:148 Species:Homo sapiens
Sequence 2:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster


Alignment Length:134 Identity:53/134 - (39%)
Similarity:76/134 - (56%) Gaps:12/134 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     7 LGL-VLLSV---TVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGD 67
            ||| :||::   .|..|.|.||||||  |.|...|:....|:||:||.:.||..:|.....|| :
  Fly    14 LGLGLLLAIECGVVSAKRFLRCELAR--KLLDQHGFERSLLSNWICLLEHESDLDTGRITTNA-N 75

Human    68 RSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRN 132
            .|.:||:||||.|: |.:|:..|   .|:..|...|.:|:.::|.|||| ::...|.|.|..|:.
  Fly    76 GSRNYGLFQINGRF-CQEGRRGG---ICNAKCEDFLDENLRESVTCAKR-IQTSDGFRHWAGWQR 135

Human   133 RCQN 136
            .|:|
  Fly   136 YCRN 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LYZNP_000230.1 LYZ_C 19..146 CDD:340383 47/118 (40%)
CG16756NP_572222.2 LYZ_C_invert 30..147 CDD:381618 47/118 (40%)

Return to query results.
Submit another query.