Sequence 1: | NP_001262292.1 | Gene: | CG31549 / 40689 | FlyBaseID: | FBgn0051549 | Length: | 257 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001227.1 | Gene: | CBR3 / 874 | HGNCID: | 1549 | Length: | 277 | Species: | Homo sapiens |
Alignment Length: | 241 | Identity: | 61/241 - (25%) |
---|---|---|---|
Similarity: | 98/241 - (40%) | Gaps: | 55/241 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSSFKDKVIIVTGASSGIGASAAVHLAK-LGGLLVIVGRNEEKLKETADNIVAAGGATPLELQAD 64
Fly 65 MTKEAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPE 129
Fly 130 L---VKTKGNIVNVSSVCGLRAF-----------------PGVLA-------------------- 154
Fly 155 ----YNVSKAAVDQFTACIALELAPK----GVRVNAVNPGVIVTDI 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31549 | NP_001262292.1 | NADB_Rossmann | 4..254 | CDD:304358 | 58/238 (24%) |
fabG | 4..251 | CDD:235975 | 58/238 (24%) | ||
CBR3 | NP_001227.1 | carb_red_PTCR-like_SDR_c | 6..277 | CDD:187585 | 58/235 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165140587 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |