DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and CBR3

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001227.1 Gene:CBR3 / 874 HGNCID:1549 Length:277 Species:Homo sapiens


Alignment Length:241 Identity:61/241 - (25%)
Similarity:98/241 - (40%) Gaps:55/241 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSFKDKVIIVTGASSGIGASAAVHLAK-LGGLLVIVGRNEEKLKETADNIVAAGGATPLELQAD 64
            |||. .:|.:||||:.|||.:.|..|.: ..|.:|:..|:..: .:.|...:.|.|.:|...|.|
Human     1 MSSC-SRVALVTGANRGIGLAIARELCRQFSGDVVLTARDVAR-GQAAVQQLQAEGLSPRFHQLD 63

  Fly    65 MTKEAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPE 129
            :.....::.:......::|.::||||||.:    :.::.....||......:::.:..|.....|
Human    64 IDDLQSIRALRDFLRKEYGGLNVLVNNAAV----AFKSDDPMPFDIKAEMTLKTNFFATRNMCNE 124

  Fly   130 L---VKTKGNIVNVSSVCGLRAF-----------------PGVLA-------------------- 154
            |   :|..|.:||:||:..||||                 .|.|.                    
Human   125 LLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMKKFVEDTKNEVHEREGW 189

  Fly   155 ----YNVSKAAVDQFTACIALELAPK----GVRVNAVNPGVIVTDI 192
                |.|||..|...:..:|..|..|    .:.|||..||.:.||:
Human   190 PNSPYGVSKLGVTVLSRILARRLDEKRKADRILVNACCPGPVKTDM 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 58/238 (24%)
fabG 4..251 CDD:235975 58/238 (24%)
CBR3NP_001227.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 58/235 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.