DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and IRC24

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_012302.3 Gene:IRC24 / 854854 SGDID:S000001475 Length:263 Species:Saccharomyces cerevisiae


Alignment Length:248 Identity:78/248 - (31%)
Similarity:117/248 - (47%) Gaps:35/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGASAAVHLAKLGGLLVIVG--RNEEKLKET-----ADNIVAAGGATPLELQAD 64
            |||::||||.|||......:.:.....::.|  |.|..|:..     ||..|..        ..|
Yeast     3 KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYR--------VLD 59

  Fly    65 MTKEAEVQQIVGATLAKHGRIDVLVNNAGILE-TGSIEATS----LEQFDRLMNTNVRSLYQLTM 124
            :|..:.::.:|.....|||::|.:|.|||:|| ..||..::    ::|::||.:.|..|:..|..
Yeast    60 ITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSLVA 124

  Fly   125 LATPELVKTK---GNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPG 186
            |..| |:|:.   ||||.|||...::.:.|..||..||||::.|...||.|.....||...:.||
Yeast   125 LCLP-LLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPG 188

  Fly   187 VIVTDIHK-------RGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFL 232
            |:.|.:.|       ..||..:...:|.:..|.:..|    |.|..||.:|.|
Yeast   189 VVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLL----DPKVPAAVLAQL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 78/248 (31%)
fabG 4..251 CDD:235975 78/248 (31%)
IRC24NP_012302.3 SPR-like_SDR_c 4..255 CDD:187625 77/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341273
Domainoid 1 1.000 86 1.000 Domainoid score I1866
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I1506
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.