DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and NRE1

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_012301.3 Gene:NRE1 / 854853 SGDID:S000001474 Length:254 Species:Saccharomyces cerevisiae


Alignment Length:190 Identity:70/190 - (36%)
Similarity:104/190 - (54%) Gaps:11/190 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGASAAVHLAKLGGLLVIVG--RNEEKLKETADNIVAAGGATPLELQADMTKEA 69
            |||:|||.|.|||.|....|..|....|:.|  |:|..||:..:..    |.....:..|:|:::
Yeast     3 KVILVTGVSRGIGKSIVDVLFSLDKDTVVYGVARSEAPLKKLKEKY----GDRFFYVVGDITEDS 63

  Fly    70 EVQQIVGATLAKHGRIDVLVNNAGILE-TGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVKT 133
            .::|:|.|.:..||:||.||.|||:|| ..::....:..:.:|.:.|..|:..|..:|.|||.||
Yeast    64 VLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIALPELKKT 128

  Fly   134 KGNIVNVSS-VCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDI 192
            .||:|.||| .|.: .|....||..||||::.|...:|.|  .:.|:..||.||::.||:
Yeast   129 NGNVVFVSSDACNM-YFSSWGAYGSSKAALNHFAMTLANE--ERQVKAIAVAPGIVDTDM 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 70/190 (37%)
fabG 4..251 CDD:235975 70/190 (37%)
NRE1NP_012301.3 SPR-like_SDR_c 4..246 CDD:187625 69/189 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341276
Domainoid 1 1.000 86 1.000 Domainoid score I1866
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I1506
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.