DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and AT1G63380

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001319302.1 Gene:AT1G63380 / 842644 AraportID:AT1G63380 Length:287 Species:Arabidopsis thaliana


Alignment Length:267 Identity:85/267 - (31%)
Similarity:140/267 - (52%) Gaps:37/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAG--GATPLELQADMTK 67
            ||||::|||||||||....:.|.|.|..:|...|..::|......|.:.|  |...:.|:.|::.
plant    23 KDKVVLVTGASSGIGREICLDLCKAGCKIVAAARRVDRLNSLCSEINSFGAIGVQAVALELDVSS 87

  Fly    68 EAE-VQQIVGATLAKHGRIDVLVNNAGILETGSIEAT---SLEQFDRLMNTNVR-----SLYQLT 123
            ||: :::.|.......|:||||:|||||  .|:::::   |.|::|::..||:.     |.|...
plant    88 EADTIRKAVKEAWETFGKIDVLINNAGI--RGNVKSSLDLSEEEWDKVFRTNLTGSWLISKYVCL 150

  Fly   124 MLATPELVKTKGNIVNVSSVCGLR--AFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPG 186
            ::...|   ..|:::||||:.||.  ...|.|||..||..||..|..:|:|||...:|||::.||
plant   151 LMRDAE---RGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIELAVYKIRVNSIAPG 212

  Fly   187 VIVTDIHKRGGMDEETYAKFLEHCKITHAL--------GRPGDVKEVAAAIAFLASDQASFTTGI 243
            :..::|.:  |:.::.:.|     |:|..:        ..||    :.:.:.:|..|.:.:.||.
plant   213 IFRSEITQ--GLFQKEWLK-----KVTEKVVPLKMQQTVDPG----LTSLVRYLIHDSSQYVTGN 266

  Fly   244 SLPVDGG 250
            :..||.|
plant   267 TYIVDSG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 85/267 (32%)
fabG 4..251 CDD:235975 85/267 (32%)
AT1G63380NP_001319302.1 fabG 22..276 CDD:235546 85/267 (32%)
SDR_c 27..271 CDD:212491 78/259 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.