DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and HSDL2

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_115679.2 Gene:HSDL2 / 84263 HGNCID:18572 Length:418 Species:Homo sapiens


Alignment Length:249 Identity:76/249 - (30%)
Similarity:108/249 - (43%) Gaps:39/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IIVTGASSGIGASAAVHLAKLGGLLVIVGRNEE---KLKET----ADNIVAAGGATPLELQADMT 66
            :.:||||.|||.:.|:..||.|..:||..:..:   ||..|    |:.|.|.||.. |....|:.
Human    13 VFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGGKA-LPCIVDVR 76

  Fly    67 KEAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELV 131
            .|.::...|...:.|.|.||:|||||..:...:...|..::.|.:||.|.|..|..:....|.|.
Human    77 DEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYLK 141

  Fly   132 KTK-GNIVNVSSVCGLRA--FPGVLAYNVSKAAVDQFTACIALELAPKG-VRVNAVNPGVIVTDI 192
            |:| .:|:|:|....|..  |....||.::|..:..:...:|.|.  || :.|||:.|   .|.|
Human   142 KSKVAHILNISPPLNLNPVWFKQHCAYTIAKYGMSMYVLGMAEEF--KGEIAVNALWP---KTAI 201

  Fly   193 HKRGGMDEETYAKFLEHCKITHALGRPG------DVKEVAAAIAFLASDQASFT 240
            | ...||               .||.||      .|..:|.|...:.....|||
Human   202 H-TAAMD---------------MLGGPGIESQCRKVDIIADAAYSIFQKPKSFT 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 76/249 (31%)
fabG 4..251 CDD:235975 76/249 (31%)
HSDL2NP_115679.2 HSDL2_SDR_c 8..248 CDD:187663 76/249 (31%)
SCP2 319..412 CDD:376720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.