DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and ABA2

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_175644.1 Gene:ABA2 / 841665 AraportID:AT1G52340 Length:285 Species:Arabidopsis thaliana


Alignment Length:265 Identity:76/265 - (28%)
Similarity:126/265 - (47%) Gaps:33/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIV-AAGGATPLELQADMTKEAE 70
            ||.::||.::|||.|......|.|..:.||...::...|...::: .....|...:..|:..|.:
plant    21 KVALITGGATGIGESIVRLFHKHGAKVCIVDLQDDLGGEVCKSLLRGESKETAFFIHGDVRVEDD 85

  Fly    71 VQQIVGATLAKHGRIDVLVNNAGI--LETGSIEATSLEQFDRLMNTNVRSLYQLTM--LATPELV 131
            :...|...:...|.:|:|:||||:  .....|...||.:|:...:.||:..: |:|  .|...:.
plant    86 ISNAVDFAVKNFGTLDILINNAGLCGAPCPDIRNYSLSEFEMTFDVNVKGAF-LSMKHAARVMIP 149

  Fly   132 KTKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDI---- 192
            :.||:||::.||.|:....|..:|..||.||...|..:|.||...|:|||.|:|..:.|.:    
plant   150 EKKGSIVSLCSVGGVVGGVGPHSYVGSKHAVLGLTRSVAAELGQHGIRVNCVSPYAVATKLALAH 214

  Fly   193 ---HKRGGMDEETYAKF---------LEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISL 245
               .:|   .|:.:..|         |:..::|        |.:||.|:.|||||.:.:.:|.:|
plant   215 LPEEER---TEDAFVGFRNFAAANANLKGVELT--------VDDVANAVLFLASDDSRYISGDNL 268

  Fly   246 PVDGG 250
            .:|||
plant   269 MIDGG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 76/265 (29%)
fabG 4..251 CDD:235975 76/265 (29%)
ABA2NP_175644.1 PLN02253 3..285 CDD:177895 76/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1923
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1924
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.