DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and AT1G07440

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_172224.1 Gene:AT1G07440 / 837256 AraportID:AT1G07440 Length:266 Species:Arabidopsis thaliana


Alignment Length:252 Identity:82/252 - (32%)
Similarity:130/252 - (51%) Gaps:12/252 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAG-GATPLELQADMT 66
            |.|.|.::|||.:.|||.:.....|..|.::....|||.:|.|........| ..|.....|.:.
plant    11 SLKAKTVLVTGGTKGIGHAIVEEFAGFGAVIHTCARNEYELNECLSKWQKKGFQVTGSVCDASLR 75

  Fly    67 KEAE-VQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPEL 130
            .|.| :.|.|.:...  |::|:|:||.|.:.:......:.|.|...::||:.|.|.|:.||.| |
plant    76 PEREKLMQTVSSMFG--GKLDILINNLGAIRSKPTLDYTAEDFSFHISTNLESAYHLSQLAHP-L 137

  Fly   131 VKTK--GNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIH 193
            :|..  |||:.:||:.|:.:......|:.:|.|::|....:|.|.|..|:|.|||.|.||.|.:.
plant   138 LKASGCGNIIFMSSIAGVVSASVGSIYSATKGALNQLARNLACEWASDGIRANAVAPAVIATPLA 202

  Fly   194 KRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGG 250
            :  .:.::.:.|.:...|   .|||.|:.:||::.:|||....||:.||.::.||||
plant   203 E--AVYDDEFKKVVISRK---PLGRFGEPEEVSSLVAFLCMPAASYITGQTICVDGG 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 81/251 (32%)
fabG 4..251 CDD:235975 81/251 (32%)
AT1G07440NP_172224.1 TR_SDR_c 9..258 CDD:187590 82/252 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 1 0.900 - - OOG6_101836
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.