DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and AT5G18210

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_197322.2 Gene:AT5G18210 / 831939 AraportID:AT5G18210 Length:277 Species:Arabidopsis thaliana


Alignment Length:261 Identity:87/261 - (33%)
Similarity:131/261 - (50%) Gaps:25/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVA----AGGATPLEL 61
            :||...:|.||||:|.|||.:.|:|||:||..:||   |.......||.:.|    :.|..|..:
plant     5 VSSLAGRVAIVTGSSRGIGRAIAIHLAELGAKIVI---NYTTRSTEADQVAAEINSSAGTVPQPI 66

  Fly    62 Q----ADMTKEAEVQQIV-GATLAKHGRIDVLVNNAGILETG--SIEATSLEQFDRLMNTNVRSL 119
            .    ||:::.::::.:. .|..|.:..:.:|||:||||...  :|..|.:|:|||:...|.|..
plant    67 AVVFLADISEPSQIKSLFDAAEKAFNSPVHILVNSAGILNPNYPTIANTPIEEFDRIFKVNTRGS 131

  Fly   120 YQLTMLATPELVK-TKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAV 183
            :.....|...|.: ..|.|:.::|.......||..||..|||||:.....:|.||...|:..|.|
plant   132 FLCCKEAAKRLKRGGGGRIILLTSSLTEALIPGQGAYTASKAAVEAMVKILAKELKGLGITANCV 196

  Fly   184 NPGVIVTDIHKRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASD-----QASFTTGI 243
            :||.:.|::. ..|..|||....:|.    ...||.|:.|::|:.:.|||||     |.|..|.|
plant   197 SPGPVATEMF-FDGKSEETVMNIIER----SPFGRLGETKDIASVVGFLASDGGFKLQFSGDTRI 256

  Fly   244 S 244
            |
plant   257 S 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 85/258 (33%)
fabG 4..251 CDD:235975 85/258 (33%)
AT5G18210NP_197322.2 fabG 7..245 CDD:235500 81/245 (33%)
NADB_Rossmann 8..245 CDD:304358 80/244 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.