DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and AT4G03140

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_567251.2 Gene:AT4G03140 / 828065 AraportID:AT4G03140 Length:343 Species:Arabidopsis thaliana


Alignment Length:257 Identity:79/257 - (30%)
Similarity:125/257 - (48%) Gaps:23/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTKEAEV 71
            ||.::||.:||||.:.|......|..::|.....:..:||...:    |.:......|:|||:::
plant    81 KVALITGGASGIGKATAGKFISHGAKVIIADIQPQIGRETEQEL----GPSCAYFPCDVTKESDI 141

  Fly    72 QQIVGATLAKHGRIDVLVNNAGI--LETGSIEATSLEQFDRLMNTNVRSLYQ-LTMLATPELVKT 133
            ...|...::.|.::|::.|||||  ....||....|..||:::|||||.:.. :...|...:.:.
plant   142 ANAVDFAVSLHTKLDIMYNNAGIPCKTPPSIVDLDLNVFDKVINTNVRGVMAGIKHAARVMIPRN 206

  Fly   134 KGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHKRGGM 198
            .|:|:...||.|:........|:|||:||.......|.||....:|||.::|..|.|..    .|
plant   207 SGSIICAGSVTGMMGGLAQHTYSVSKSAVIGIVRSTASELCKHRIRVNCISPFAITTSF----VM 267

  Fly   199 DE--ETY-----AKFLEHCKITHALGRPGDVKE---VAAAIAFLASDQASFTTGISLPVDGG 250
            ||  :.|     ::.::..:.|..|.  |:|.|   ||.|..:||||.:.:..|.:|.||||
plant   268 DEMRQIYPGVDDSRLIQIVQSTGVLN--GEVCEPTDVANAAVYLASDDSKYVNGHNLVVDGG 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 79/257 (31%)
fabG 4..251 CDD:235975 79/257 (31%)
AT4G03140NP_567251.2 PLN02253 77..331 CDD:177895 79/257 (31%)
NADB_Rossmann 77..329 CDD:304358 79/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.