DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and AT4G13180

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_193054.1 Gene:AT4G13180 / 826932 AraportID:AT4G13180 Length:263 Species:Arabidopsis thaliana


Alignment Length:255 Identity:72/255 - (28%)
Similarity:120/255 - (47%) Gaps:21/255 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIV-----AAGGATPLELQADMT 66
            :|.|||||:.|:|...|:||..||..:.|   |.......|:.:|     ::...:.:.::||::
plant    16 RVAIVTGATRGMGREIAIHLHSLGARVTI---NYVSSSSKAELLVSELNDSSQLKSAIAVKADVS 77

  Fly    67 KEAEVQQIVGATLAKHG-RIDVLVNNAGILET--GSIEATSLEQFDRLMNTNVRSLYQLTMLATP 128
            ...::..:...|..:.| ::.::||.||:|:.  .|:..|:||.||.....|.|..:.....|..
plant    78 DPDQINNLFDQTEQEFGSKVHIVVNCAGVLDPKYPSLSETTLEDFDNTFTINTRGSFLCCKEAAK 142

  Fly   129 ELVKTKGN---IVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVT 190
            .:::..|.   :::.|.|.||.  ||...|..|||||:.....:|.||....:..|.|.||.:.|
plant   143 RVMRGGGGRIIMMSTSMVGGLA--PGYGVYAASKAAVETMVKVLAKELKGSRITANCVAPGPVAT 205

  Fly   191 DIHKRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGG 250
            ::...|..| ||.......|    .:||.|:.|::...:.|||.|...:..|..:..:||
plant   206 EMFYAGKSD-ETVKMLAGAC----PMGRIGESKDITEIVGFLAGDGGEWINGQVIRANGG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 72/255 (28%)
fabG 4..251 CDD:235975 72/255 (28%)
AT4G13180NP_193054.1 THN_reductase-like_SDR_c 13..262 CDD:187620 72/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.