DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and AT3G55290

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_567019.1 Gene:AT3G55290 / 824695 AraportID:AT3G55290 Length:280 Species:Arabidopsis thaliana


Alignment Length:260 Identity:81/260 - (31%)
Similarity:137/260 - (52%) Gaps:24/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETAD--NIVAAGGATPLELQADMTK 67
            ||||::|||||||||....:.|||.|..::...|..::|.....  |..::.|.....|:.|::.
plant    19 KDKVVLVTGASSGIGREICLDLAKAGCQVIAAARRVDRLNSLCSEINSFSSTGIQAAALELDVSS 83

  Fly    68 E-AEVQQIVGATLAKHGRIDVLVNNAGILETGSIEAT---SLEQFDRLMNTNVRSLY----QLTM 124
            : |.:|:.|.......|:||.|:|||||  .|:::::   |.:::|.:..||::..:    .:.|
plant    84 DAATIQKAVREAWDIFGKIDALINNAGI--RGNVKSSLDLSEDEWDNVFKTNLKGPWLVSKHVCM 146

  Fly   125 LATPELVKTKGNIVNVSSVCGLRA-FPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVI 188
            |...  .|..|:::|:||:.|:|. .||.|||..||..||..:..:||||....:|||::.||:.
plant   147 LMRD--AKRGGSVINISSIAGIRGMLPGGLAYACSKGGVDTMSRMMALELGVHKIRVNSIAPGLF 209

  Fly   189 VTDIHKRGGMDEETYAKFLEH---CKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGG 250
            .::| .:|.|.:|......|.   .|:...:. ||    :.:.:.:|..|.:.:.:|.:..||.|
plant   210 KSEI-TQGLMQKEWLKNVTERTVPLKVQQTVD-PG----LTSLVRYLIHDSSQYISGNTYIVDSG 268

  Fly   251  250
            plant   269  268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 81/260 (31%)
fabG 4..251 CDD:235975 81/260 (31%)
AT3G55290NP_567019.1 fabG 18..271 CDD:235546 81/260 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1153
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.