DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and AT3G46170

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_190203.1 Gene:AT3G46170 / 823760 AraportID:AT3G46170 Length:288 Species:Arabidopsis thaliana


Alignment Length:261 Identity:82/261 - (31%)
Similarity:138/261 - (52%) Gaps:26/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAG--GATPLELQADMTK 67
            ||||::|||||||||....:.|.|.|..::.|.|..::|......|.::.  |.....|:.|:|.
plant    27 KDKVVLVTGASSGIGREICLDLGKAGCKIIAVARRVDRLNSLCSEINSSSSTGIQAAALKLDVTS 91

  Fly    68 E-AEVQQIVGATLAKHGRIDVLVNNAGILETGSIEAT---SLEQFDRLMNTNVR-----SLYQLT 123
            : |.:|::|.......|:||.|:|||||  .|:::::   |.|::|.:..||:.     |.|...
plant    92 DAATIQKVVQGAWGIFGKIDALINNAGI--RGNVKSSLDLSKEEWDNVFKTNLTGPWLVSKYVCV 154

  Fly   124 MLATPELVKTKGNIVNVSSVCGLRA-FPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGV 187
            ::..   .|..|:::|:||:.|:|. .||.|||..||..||..:..:|:||....:|||::.||:
plant   155 LMRD---AKLGGSVINISSIAGIRGILPGALAYACSKIGVDTMSKMMAVELGVHKIRVNSIAPGI 216

  Fly   188 IVTDIHKRGGMDEETYAKFLEH---CKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDG 249
            ..::| .:|.|.:|.:....|.   .|:...:. ||    :.:.:.:|..|.:.:.:|.:..||.
plant   217 FKSEI-TQGLMQKEWFKNVTERTVPLKLQQTVD-PG----ITSLVRYLIHDSSQYISGNTYIVDS 275

  Fly   250 G 250
            |
plant   276 G 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 82/261 (31%)
fabG 4..251 CDD:235975 82/261 (31%)
AT3G46170NP_190203.1 SDR_c 31..274 CDD:212491 75/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1153
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.