DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and ATA1

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_189882.1 Gene:ATA1 / 823352 AraportID:AT3G42960 Length:272 Species:Arabidopsis thaliana


Alignment Length:262 Identity:89/262 - (33%)
Similarity:135/262 - (51%) Gaps:29/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTKEAE 70
            :||.|:||.:.||||:.|....:.|..:::....|.:....|::|   ||.   .:..|::|||:
plant    10 EKVAIITGGARGIGAATARLFTENGAYVIVADILENEGILVAESI---GGC---YVHCDVSKEAD 68

  Fly    71 VQQIVGATLAKHGRIDVLVNNAGI-LETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVK-- 132
            |:..|...:.:.||:||:.||||: |..|||....::..::|::.||..:......|...::|  
plant    69 VEAAVELAMRRKGRLDVMFNNAGMSLNEGSIMGMDVDMVNKLVSVNVNGVLHGIKHAAKAMIKGG 133

  Fly   133 TKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHKRGG 197
            ..|:|:..||..||....|..||.:||.|::......|.||...|:|||:::|..:.|||.    
plant   134 RGGSIICTSSSSGLMGGLGGHAYTLSKGAINGVVRTTACELGSHGIRVNSISPHGVPTDIL---- 194

  Fly   198 MDEETYAKFLEHCKITHA-------------LGRPGDVKEVAAAIAFLASDQAS-FTTGISLPVD 248
              ...|.|||.|.|:..|             .||.|.|::||.|..||||.::| |.||.:|.||
plant   195 --VNAYRKFLNHDKLNVAEVTDIIAEKGSLLTGRAGTVEDVAQAALFLASQESSGFITGHNLVVD 257

  Fly   249 GG 250
            ||
plant   258 GG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 89/262 (34%)
fabG 4..251 CDD:235975 89/262 (34%)
ATA1NP_189882.1 PLN02253 4..268 CDD:177895 89/262 (34%)
NADB_Rossmann 7..261 CDD:304358 89/262 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1924
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.