DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and SDR4

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_189570.3 Gene:SDR4 / 822580 AraportID:AT3G29250 Length:298 Species:Arabidopsis thaliana


Alignment Length:255 Identity:89/255 - (34%)
Similarity:122/255 - (47%) Gaps:23/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLEL-QADMTKEAE 70
            |:.|:||.:|||||.|.......|..:|||...|    |...|:..:.|...... :.::|.|.:
plant    47 KIAIITGGASGIGAEAVRLFTDHGAKVVIVDIQE----ELGQNLAVSIGLDKASFYRCNVTDETD 107

  Fly    71 VQQIVGATLAKHGRIDVLVNNAGILET-GSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVK-- 132
            |:..|..|:.|||::|||.:|||:||. ||:....||.|||.|..|||........|...:|.  
plant   108 VENAVKFTVEKHGKLDVLFSNAGVLEAFGSVLDLDLEAFDRTMAVNVRGAAAFIKHAARSMVASG 172

  Fly   133 TKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHKRGG 197
            |:|:||..:|:......||..:|..||.|:..........|...|:|||.|.|..:.|      |
plant   173 TRGSIVCTTSIAAEIGGPGPHSYTASKHALLGLIRSACAGLGQYGIRVNGVAPYGVAT------G 231

  Fly   198 MD---EETYAKFLEHCKITHALGRPGDV----KEVAAAIAFLASDQASFTTGISLPVDGG 250
            |.   .|...|.||  :...|||....|    :.:|.|..|||||.:.:.:|.:|.||||
plant   232 MTSAYNEEAVKMLE--EYGEALGNLKGVVLKARHIAEAALFLASDDSVYISGQNLVVDGG 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 89/255 (35%)
fabG 4..251 CDD:235975 89/255 (35%)
SDR4NP_189570.3 PLN02253 42..293 CDD:177895 89/255 (35%)
NADB_Rossmann 44..291 CDD:304358 89/255 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1923
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1924
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.