DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and AT3G26760

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_189311.2 Gene:AT3G26760 / 822289 AraportID:AT3G26760 Length:300 Species:Arabidopsis thaliana


Alignment Length:261 Identity:82/261 - (31%)
Similarity:136/261 - (52%) Gaps:28/261 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAG-GATPLELQADMTKEAE 70
            ||.::||.:||||.:.|......|..::||..:||     |.::||.. |:....|:.|:|:|.:
plant    39 KVAVITGGASGIGKATAEEFVSQGAQVIIVDIDEE-----AGHMVATELGSAAHFLRCDVTEEEQ 98

  Fly    71 VQQIVGATLAKHGRIDVLVNNAGI---LETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVK 132
            :.:.|...:.:||::||::|:|||   :...||....::.:|::|..|||.    |:|......:
plant    99 IAKAVETAVTRHGKLDVMLNSAGISCSISPPSIADLDMDTYDKVMRLNVRG----TVLGIKHAAR 159

  Fly   133 T-----KGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDI 192
            .     .|:|:.:||:.||....|..||::||..:......:|.||...|:|:|.::|..|.|.:
plant   160 AMIPAGSGSILCLSSISGLMGGLGPHAYSISKFTIPGVVKTVASELCKHGLRINCISPAGIPTPL 224

  Fly   193 HKRGGMDEETYA-KFLEHCKITHALGRPGDVK-------EVAAAIAFLASDQASFTTGISLPVDG 249
            ..|  |..|.:| ..:...::...:...|::|       :||.|..:||||.|.|.||.:|.|||
plant   225 TLR--MFREAFAGHSIREEQLLAIVNATGELKGEKCEEIDVAKAALYLASDDAKFVTGHNLVVDG 287

  Fly   250 G 250
            |
plant   288 G 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 82/261 (31%)
fabG 4..251 CDD:235975 82/261 (31%)
AT3G26760NP_189311.2 PLN02253 30..291 CDD:177895 82/261 (31%)
NADB_Rossmann 35..290 CDD:304358 82/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.