DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and AT3G04000

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_566221.2 Gene:AT3G04000 / 819555 AraportID:AT3G04000 Length:272 Species:Arabidopsis thaliana


Alignment Length:263 Identity:77/263 - (29%)
Similarity:129/263 - (49%) Gaps:29/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAA-----------GGATP-- 58
            :|.||||:|.|||.:.|:|||:||..:|:   |.......|:.:..|           .|.:|  
plant    17 RVAIVTGSSRGIGRAIAIHLAELGARVVV---NYSTSPVEAEKVATAITTNCSKDAEVAGKSPRV 78

  Fly    59 LELQADMTKEAEVQQIVG-ATLAKHGRIDVLVNNAGILET--GSIEATSLEQFDRLMNTNVRSLY 120
            :.::||:::.::|:.:.. |.......:.:|||:|.|.:.  .:|...|:|.|||:::.|.|..:
plant    79 IVVKADISEPSQVKSLFDEAERVFESPVHILVNSAAIADPNHSTISDMSVELFDRIISVNTRGAF 143

  Fly   121 QLTMLATPELVKTKGN---IVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNA 182
            .....|...|.:..|.   :::.|.|..|....|  :|..|||||:.....:|.||....:.||.
plant   144 ICAREAANRLKRGGGGRIILLSTSLVQTLNTNYG--SYTASKAAVEAMAKILAKELKGTEITVNC 206

  Fly   183 VNPGVIVTDIHKRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPV 247
            |:||.:.|::...|..:|     .:|..|..:..||.|:.|::|..:.|||||...:..|..:..
plant   207 VSPGPVATEMFYTGLSNE-----IVEKVKSQNLFGRIGETKDIAPVVGFLASDAGEWINGQVIMA 266

  Fly   248 DGG 250
            :||
plant   267 NGG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 77/263 (29%)
fabG 4..251 CDD:235975 77/263 (29%)
AT3G04000NP_566221.2 SDR 14..269 CDD:330230 75/261 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.