DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and SDR5

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_566097.1 Gene:SDR5 / 819327 AraportID:AT2G47140 Length:257 Species:Arabidopsis thaliana


Alignment Length:259 Identity:78/259 - (30%)
Similarity:123/259 - (47%) Gaps:19/259 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTKEAEV 71
            |::|:||.:|||||.:.....:.|..:|||...:|..:..|   |:.|.........|:|.|.||
plant     9 KIVIITGGASGIGAESVRLFTEHGARVVIVDVQDELGQNVA---VSIGEDKASYYHCDVTNETEV 70

  Fly    72 QQIVGATLAKHGRIDVLVNNAGILET-GSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVK--T 133
            :..|..|:.|:|::|||.:|||::|. .||...:|.:.||.:..|:|........|...:|:  .
plant    71 ENAVKFTVEKYGKLDVLFSNAGVIEPFVSILDLNLNELDRTIAINLRGTAAFIKHAARAMVEKGI 135

  Fly   134 KGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHKRG-- 196
            :|:||..:||....|......|..||..:.......:..|...|:|||.|.|..:.|.:...|  
plant   136 RGSIVCTTSVAAEIAGTAPHGYTTSKHGLLGLIKSASGGLGKYGIRVNGVAPFGVATPLVCNGFK 200

  Fly   197 ----GMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGGRHAMCP 256
                .:::.|.|.       .:..|.....:.||.|..|||||::::.:|.:|.||||...:.|
plant   201 MEPNVVEQNTSAS-------ANLKGIVLKARHVAEAALFLASDESAYVSGQNLAVDGGYSVVKP 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 77/255 (30%)
fabG 4..251 CDD:235975 76/252 (30%)
SDR5NP_566097.1 PLN02253 1..255 CDD:177895 77/255 (30%)
NADB_Rossmann 5..253 CDD:304358 77/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1923
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1924
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.