DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and AT2G47120

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001325398.1 Gene:AT2G47120 / 819325 AraportID:AT2G47120 Length:259 Species:Arabidopsis thaliana


Alignment Length:271 Identity:89/271 - (32%)
Similarity:125/271 - (46%) Gaps:33/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADM 65
            :|..:.|::|:||.:|||||.||......|..:|||...||..:..|   |..|.......:.|:
plant     4 LSRLEGKIVIITGGASGIGADAARLFTDHGAKVVIVDVQEELGQNVA---VLIGKDKASFYRCDV 65

  Fly    66 TKEAEVQQIVGATLAKHGRIDVLVNNAGILE-TGSIEATSLEQFDRLMNTNVRSLYQLTMLATPE 129
            |.|.||:..|..|:.|||::|||.:|||:|| ..|.....||:|||:|..|||........|...
plant    66 TNETEVEDAVKFTVEKHGKLDVLFSNAGVLEPLESFLDFDLERFDRIMAVNVRGAAAFIKHAARA 130

  Fly   130 LVK--TKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDI 192
            :|:  |:|:||..:|| ......|...|..||..:.........:|...|:|||.|.|..:.|.:
plant   131 MVEKGTRGSIVCTTSV-SAEIGGGHHGYTASKHGLVGLIRSACGDLGKYGIRVNGVAPYAVATPM 194

  Fly   193 HKRGGMDEETYAKFLEH------------CKITHALGRPGDVKEVAAAIAFLASDQASFTTGISL 245
            ...    :|...|.||.            .|.:|          ||....|||||.:::.:|.:|
plant   195 TSH----DEVTGKQLEDYFDAKGILKGMVLKASH----------VAQVALFLASDDSAYISGQNL 245

  Fly   246 PVDGGRHAMCP 256
            .||||...:.|
plant   246 AVDGGYTVVKP 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 87/264 (33%)
fabG 4..251 CDD:235975 86/261 (33%)
AT2G47120NP_001325398.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1923
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1924
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.