DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and AT2G29320

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_180493.1 Gene:AT2G29320 / 817481 AraportID:AT2G29320 Length:269 Species:Arabidopsis thaliana


Alignment Length:266 Identity:78/266 - (29%)
Similarity:129/266 - (48%) Gaps:38/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNE----EKLKETADNIVAAGGATPLELQA 63
            |.:....:||||:||||.:....||..|..:.|...::    :.|.|..:......|:.     .
plant    12 SLQGMTALVTGAASGIGYAIVEELAGFGAKIHICDISKTLLNQSLSEWENKGFQVSGSV-----C 71

  Fly    64 DMTKEAEVQQIVGATLAK--HGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLA 126
            |:|...|.:::: .|::.  .|::::||||.|:|..........:.|...::||:.:.|....|:
plant    72 DVTSHPEREKLM-QTVSSIFDGKLNILVNNVGVLRGKPTTEYVADDFTFHISTNLEAAYHFCQLS 135

  Fly   127 TPELVKTK--GNIVNVSSVCGLRAF--PGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGV 187
            .| |:|..  |:||.:|||.|:.:.  .|.: |.::|.|::|....:|.|.|..|:|.|||.|.|
plant   136 HP-LLKASGYGSIVFLSSVAGVVSLIDCGSI-YGLTKGALNQLARNLACEWAKDGIRANAVAPNV 198

  Fly   188 IVT--------DIHKRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGIS 244
            :.|        |:.|:.|:...|            .|||.|:..||::.:.||....||:.||.:
plant   199 VKTAQSQSFLEDVSKKEGLLSRT------------PLGRVGEPNEVSSLVVFLCLPAASYITGQT 251

  Fly   245 LPVDGG 250
            :.||||
plant   252 ICVDGG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 77/265 (29%)
fabG 4..251 CDD:235975 77/265 (29%)
AT2G29320NP_180493.1 PRK09242 10..263 CDD:181721 78/266 (29%)
NADB_Rossmann 11..261 CDD:304358 78/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 1 0.900 - - OOG6_101836
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.800

Return to query results.
Submit another query.