DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and HSD17B8

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_055049.1 Gene:HSD17B8 / 7923 HGNCID:3554 Length:261 Species:Homo sapiens


Alignment Length:260 Identity:79/260 - (30%)
Similarity:126/260 - (48%) Gaps:25/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLE--------- 60
            :..:.:||||.||||.:.:|.||..|..:.....:....:||   :...||....|         
Human    10 RSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQET---VRLLGGPGSKEGPPRGNHAA 71

  Fly    61 LQADMTKEAEVQQIVGATLAKHGR-IDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTM 124
            .|||:::....:.::....|...| ..|:|:.|||.:...:...|.:.:|:::..|::..:.:|.
Human    72 FQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQ 136

  Fly   125 LATPELVKT--KGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGV 187
            .|...||..  :|:|:|:||:.|.....|...|..|||.|...|...|.||...|:|.|:|.||.
Human   137 AAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGF 201

  Fly   188 IVTDIHKRGGMDEETYAKFLEHCKITH--ALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGG 250
            |.|.      |.::...|.::  |||.  .:|..||.::||..:|||||:.:.:.||.|:.|.||
Human   202 IATP------MTQKVPQKVVD--KITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGG 258

  Fly   251  250
            Human   259  258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 79/260 (30%)
fabG 4..251 CDD:235975 79/260 (30%)
HSD17B8NP_055049.1 BKR_SDR_c 13..260 CDD:187594 79/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.