DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and Dhrs2

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_082066.2 Gene:Dhrs2 / 71412 MGIID:1918662 Length:282 Species:Mus musculus


Alignment Length:249 Identity:83/249 - (33%)
Similarity:125/249 - (50%) Gaps:7/249 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTK 67
            |...||.::||::.|||.:.|..||:.|..:||..|.:|.:.| |..|:...|.:.......:.|
Mouse    34 SLAGKVAVITGSTRGIGFAIARRLAQDGAHVVISSRKQENVDE-AVTILKEEGLSVTGTMCHVGK 97

  Fly    68 EAEVQQIVGATLAKHGRIDVLVNNAGILE-TGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELV 131
            ..:.|.:|...|...|.||.||..||:.. .||....|.:.:|::::.||:|...|.....|.:.
Mouse    98 AEDRQHLVTTALKHSGGIDFLVCVAGVNPLVGSTLGASEQIWDKILDVNVKSPALLLSKVLPYME 162

  Fly   132 KTK-GNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHKR 195
            ..: |::|.|||.......|.:..||.||.|:......:|:||||||:|||.:.||:|.||...|
Mouse   163 NRRGGSVVLVSSGVAYVPVPKLGVYNTSKTALLGLCKSLAVELAPKGIRVNCLVPGIIKTDFSLR 227

  Fly   196 GGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDG 249
                |:|....|........:.|.|:.:|.|..::||.|..||:.||.::.|.|
Mouse   228 ----EKTMPNMLPDMNKIFGVKRLGEPEECAGLVSFLCSSDASYITGENIMVAG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 82/248 (33%)
fabG 4..251 CDD:235975 82/248 (33%)
Dhrs2NP_082066.2 NADB_Rossmann 35..277 CDD:389744 81/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830567
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.