DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and Dhrs2

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_001078405.4 Gene:Dhrs2 / 691464 RGDID:1583909 Length:289 Species:Rattus norvegicus


Alignment Length:245 Identity:85/245 - (34%)
Similarity:124/245 - (50%) Gaps:7/245 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTKEAEV 71
            ||.:|||::.|||.:.|..:|:.|..:||..|.:|.:||..| |:...|.:.......:.|..:.
  Rat    45 KVAVVTGSTRGIGFAIARRMARDGAHVVISSRKQENVKEAVD-ILKEEGLSVTGTVCHVGKAEDR 108

  Fly    72 QQIVGATLAKHGRIDVLVNNAGILE-TGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVKTKG 135
            |.:|...|...|.||.||..||:.. .||..|.|.:.:|::::.||:|...|.....|.:....|
  Rat   109 QHLVTTALKHSGGIDFLVCVAGVNPLVGSTLAASEQIWDKILDVNVKSPALLLSQVLPHMENRGG 173

  Fly   136 N-IVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHKRGGMD 199
            . :|.|||.......|.:..||.||.|:......:|:||||||:|||.:.||:|.||...|    
  Rat   174 GCVVLVSSAVAYLPVPRLGVYNTSKTALLGLCKSLAVELAPKGIRVNCLAPGIIKTDFSLR---- 234

  Fly   200 EETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDG 249
            |||....|...|....:.|.|:.:|.|..::||.|...|:.||.::.|.|
  Rat   235 EETMPNMLPELKKVFGVQRLGEPEECAGLVSFLCSSDGSYITGENIVVGG 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 85/245 (35%)
fabG 4..251 CDD:235975 85/245 (35%)
Dhrs2XP_001078405.4 NADB_Rossmann 42..287 CDD:304358 85/245 (35%)
fabG 42..284 CDD:235975 84/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334279
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.