DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and Hsd17b14

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001178040.1 Gene:Hsd17b14 / 691018 RGDID:1588673 Length:270 Species:Rattus norvegicus


Alignment Length:255 Identity:90/255 - (35%)
Similarity:131/255 - (51%) Gaps:21/255 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLEL------Q 62
            :..||::|||.|.||||:........|..:|...::|           |.|.|...||      .
  Rat     7 YSGKVVVVTGGSRGIGAAIVRAFVDSGAQVVFCDKDE-----------AGGRAVEQELLGTVFIP 60

  Fly    63 ADMTKEAEVQQIVGATLAKHGRIDVLVNNAGILETGSI-EATSLEQFDRLMNTNVRSLYQLTMLA 126
            .|:|:|.::|.::..|:::.|.:|.:|||||......: |.||.:.|.:|:..|:...|.|..||
  Rat    61 GDVTQEGDLQTLISETVSRFGHLDCVVNNAGYHPPAQLPEETSAQGFRQLLEENLLGAYTLIKLA 125

  Fly   127 TPELVKTKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTD 191
            .|.|.|:||||:|:||:.|.......|.|..:|.||...|..:||:.:..|||||.::||.|.|.
  Rat   126 LPHLRKSKGNIINISSLVGAIGQSQALTYVATKGAVTAMTKALALDESRYGVRVNCISPGNIWTP 190

  Fly   192 I-HKRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGG 250
            : .:......:..|..||. .:...|||.|...||.||..|||| :|:|.||:.|.:.||
  Rat   191 LWQELAAATSDPRATILEG-TLAQPLGRMGQPAEVGAAAVFLAS-EATFCTGLELFMTGG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 90/255 (35%)
fabG 4..251 CDD:235975 90/255 (35%)
Hsd17b14NP_001178040.1 NADB_Rossmann 1..256 CDD:419666 90/255 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5174
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4383
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm44989
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.