DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and Hsd17b14

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_079606.3 Gene:Hsd17b14 / 66065 MGIID:1913315 Length:273 Species:Mus musculus


Alignment Length:258 Identity:93/258 - (36%)
Similarity:134/258 - (51%) Gaps:21/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQ--- 62
            ::.:..||::|||.|.||||:........|..:|...::|           |.|.|...||.   
Mouse     4 VTRYSGKVVVVTGGSRGIGAAIVRAFVDSGAQVVFCDKDE-----------AGGRALEQELSGTV 57

  Fly    63 ---ADMTKEAEVQQIVGATLAKHGRIDVLVNNAGILETGSI-EATSLEQFDRLMNTNVRSLYQLT 123
               .|:|:|.::|.:|..||::.|.:|.:|||||......: |.||.:.|.:|:..|:...|.|.
Mouse    58 FIPGDVTQERDLQTLVSETLSRFGHLDCVVNNAGYHPPAQLPEETSAQGFRQLLEVNLLGTYTLI 122

  Fly   124 MLATPELVKTKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVI 188
            .||.|.|.|::|||:|:||:.|.......|.|..:|.||...|..:||:.:..|||||.::||.|
Mouse   123 KLALPHLRKSRGNIINISSLVGAIGQSQALTYVATKGAVTAMTKALALDESRHGVRVNCISPGNI 187

  Fly   189 VTDI-HKRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGG 250
            .|.: .:......:..|..||. .:...|||.|...|||||..|||| :|:|.||:.|.|.||
Mouse   188 WTPLWEELAASTSDPRATILEG-TLAQPLGRMGQPAEVAAAAVFLAS-EATFCTGLELLVTGG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 93/255 (36%)
fabG 4..251 CDD:235975 93/255 (36%)
Hsd17b14NP_079606.3 NADB_Rossmann 1..256 CDD:304358 93/258 (36%)
fabG 8..251 CDD:235546 93/254 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 131 1.000 Domainoid score I5109
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4415
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm42920
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.