DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and Decr2

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_741993.1 Gene:Decr2 / 64461 RGDID:71002 Length:292 Species:Rattus norvegicus


Alignment Length:255 Identity:78/255 - (30%)
Similarity:123/255 - (48%) Gaps:8/255 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTKEA 69
            :|||..:||..||||...|....:.|...|||.|:..::.|.|..:|||.|...|.|..|:....
  Rat    27 QDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVSRSLPRVSEAAKKLVAATGKRCLPLSMDVRVPP 91

  Fly    70 EVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVKTK 134
            .|...|...|.:.|:||:|:|.|.........|.|...|..:::.:....:.::.:...:..:..
  Rat    92 AVMAAVDQALKEFGKIDILINCAAGNFLCPASALSFNAFKTVVDIDTLGTFNVSRVLYEKFFRDH 156

  Fly   135 GN-IVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVI--VTDIHKRG 196
            |. |||:::...:|.....|....:|||||..|..:|:|..|:.:|||::.||.|  ...:.:.|
  Rat   157 GGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISGTEGLRRLG 221

  Fly   197 GMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGGRHAMCP 256
            |....:..|:|     :..:.|.|...|:|.::.:|||..||:.:||.|.||||.....|
  Rat   222 GPKASSKFKYL-----SSPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTLP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 77/251 (31%)
fabG 4..251 CDD:235975 76/248 (31%)
Decr2NP_741993.1 TER_DECR_SDR_a 26..273 CDD:187627 77/250 (31%)
Substrate binding. /evidence=ECO:0000250 126..128 1/1 (100%)
Microbody targeting signal 290..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.