DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and BDH2

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_006714337.1 Gene:BDH2 / 56898 HGNCID:32389 Length:259 Species:Homo sapiens


Alignment Length:279 Identity:88/279 - (31%)
Similarity:131/279 - (46%) Gaps:52/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLE----L 61
            |.....||||:|.|:.|||.:||:..|:.|..::....||.||:|             ||    :
Human     1 MGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQE-------------LEKYPGI 52

  Fly    62 QA---DMTKEAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLT 123
            |.   |:||:.::.|.....    .|:|||.|.||.:..|::.....:.:|..||.||||:|.:.
Human    53 QTRVLDVTKKKQIDQFANEV----ERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMI 113

  Fly   124 MLATPELVKTK-GNIVNVSSVCG----------------LRAFPGVLAYNVSKAAVDQFTACIAL 171
            ....|:::..| |||:|:|||..                ||.. ....|:.:||||...|..:|.
Human   114 KAFLPKMLAQKSGNIINMSSVASSVKVMATDDEKLRLPMLRVV-NRCVYSTTKAAVIGLTKSVAA 177

  Fly   172 ELAPKGVRVNAVNPGVIVTD-----IHKRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAF 231
            :...:|:|.|.|.||.:.|.     |..||. .||....||:..|    .||....:|:|....:
Human   178 DFIQQGIRCNCVCPGTVDTPSLQERIQARGN-PEEARNDFLKRQK----TGRFATAEEIAMLCVY 237

  Fly   232 LASDQASFTTGISLPVDGG 250
            ||||::::.||..:.:|||
Human   238 LASDESAYVTGNPVIIDGG 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 87/276 (32%)
fabG 4..251 CDD:235975 87/276 (32%)
BDH2XP_006714337.1 DHRS6_like_SDR_c 5..259 CDD:187626 87/275 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.