DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and PECR

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_060911.2 Gene:PECR / 55825 HGNCID:18281 Length:303 Species:Homo sapiens


Alignment Length:253 Identity:84/253 - (33%)
Similarity:125/253 - (49%) Gaps:14/253 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETAD----NIVAAGGATPLELQADMTK 67
            :|.||||.::|||.:....|.:||..:||..|..|:||..||    |:.....|..:.:|.::..
Human    19 QVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIPIQCNIRN 83

  Fly    68 EAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVK 132
            |.||..:|.:||...|:|:.||||.|.......|..|.:.:..::.||:...:.:........:|
Human    84 EEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMK 148

  Fly   133 TK-GNIVNVSSVCGLRA-FPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIV--TDIH 193
            .. |:|||:  :...:| ||..:....::|.|...|..:|||.|..|:|:|.|.||||.  |.:.
Human   149 EHGGSIVNI--IVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVE 211

  Fly   194 KRGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGGR 251
            ..|...:    .|.|.........|.|..:||::.:.||.|..|||.||.|:.|||||
Human   212 NYGSWGQ----SFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 84/253 (33%)
fabG 4..251 CDD:235975 82/251 (33%)
PECRNP_060911.2 TER_DECR_SDR_a 16..267 CDD:187627 84/253 (33%)
Microbody targeting signal 301..303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.