DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and pecr

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001017727.1 Gene:pecr / 550422 ZFINID:ZDB-GENE-050417-232 Length:299 Species:Danio rerio


Alignment Length:259 Identity:81/259 - (31%)
Similarity:133/259 - (51%) Gaps:20/259 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIV------AAGGATPLELQ 62
            |..||.:|||..:|||.:....|.:||..:||..|..|:||..|:.:.      :....||:|  
Zfish    12 FNHKVAVVTGGGTGIGKAITSELLQLGCSVVISSRKLERLKSAAEELTLKIPSSSPAKVTPIE-- 74

  Fly    63 ADMTKEAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLAT 127
            .::..|.||:.::.:||..|||||.||||.|...:......|.:.:..:::||:...:.....|.
Zfish    75 CNIRNEDEVKNLMASTLKLHGRIDFLVNNGGGQFSSPANMMSAKGWKAVIDTNLNGTFLCCREAY 139

  Fly   128 PELVKTKGNIVNVSSVCGL-RAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTD 191
            ...:|..|.:: |:.:..: :.|||:.....::||||..|..:|:|.|..|||:|:|.||.|:: 
Zfish   140 NAWMKDHGGVI-VNIIADMWKGFPGMAHTGAARAAVDNLTKSLAIEWAHSGVRINSVAPGTIIS- 202

  Fly   192 IHKRGGMDEETYAKFLEHCKITHA----LGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGGR 251
              |....:.:.|...|....:..:    ||.|   :|::.|:.||.|..|::.||.:|.||.|:
Zfish   203 --KTAMENYKEYGPTLFKMSVPFSPAKRLGVP---EEISPAVCFLLSPAANYITGATLKVDAGQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 81/259 (31%)
fabG 4..251 CDD:235975 80/257 (31%)
pecrNP_001017727.1 fabG 28..263 CDD:235546 72/243 (30%)
TER_DECR_SDR_a 28..263 CDD:187627 72/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.