DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and zgc:113054

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001013468.1 Gene:zgc:113054 / 541322 ZFINID:ZDB-GENE-050320-9 Length:551 Species:Danio rerio


Alignment Length:249 Identity:77/249 - (30%)
Similarity:132/249 - (53%) Gaps:11/249 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTKEAEV 71
            ||..||||..|||.:.|..|.:.|..:.|:..:..|.::.|..:... |.:.:.:.||::|..:|
Zfish   307 KVAYVTGAGQGIGRAFAHALGEAGAKVAIIDMDRGKAEDVAHELTLK-GISSMAVVADISKPDDV 370

  Fly    72 QQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVKT-KG 135
            |:::...:.|.|.:.:..|||||.:..:.|.||||::|:..|.|:|..:.....|...::|. .|
Zfish   371 QKMIDDIVTKWGTLHIACNNAGINKNSASEETSLEEWDQTFNVNLRGTFMCCQAAGRVMLKQGYG 435

  Fly   136 NIVNVSSVCGLRAFP---GVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHKRGG 197
            .|:|.:|:..| ..|   ..|:||.|||.|.:.|..:..|...:|||||.::||::.|.:     
Zfish   436 KIINTASMASL-IVPHPQKQLSYNTSKAGVVKLTQTLGTEWIDRGVRVNCISPGIVDTPL----- 494

  Fly   198 MDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGGR 251
            :..|:....::........||...|.::.||:.:||||.:.:.||.:|.::||:
Zfish   495 IHSESLEPLVQRWLSDIPAGRLAQVTDLQAAVVYLASDASDYMTGHNLVIEGGQ 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 77/249 (31%)
fabG 4..251 CDD:235975 76/247 (31%)
zgc:113054NP_001013468.1 YrrM 40..270 CDD:226607
AdoMet_MTases 59..270 CDD:302624
NADB_Rossmann 299..548 CDD:304358 76/247 (31%)
fabG 303..550 CDD:235546 77/249 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.