DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and HSD17B14

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_057330.2 Gene:HSD17B14 / 51171 HGNCID:23238 Length:270 Species:Homo sapiens


Alignment Length:267 Identity:92/267 - (34%)
Similarity:130/267 - (48%) Gaps:45/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQ------ 62
            :..||::|||...||||.........|..:||..::|           :.|.|...||.      
Human     7 YAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDE-----------SGGRALEQELPGAVFIL 60

  Fly    63 ADMTKEAEVQQIVGATLAKHGRIDVLVNNAGILETGS-IEATSLEQFDRLMNTNVRSLYQLTMLA 126
            .|:|:|.:|:.:|..|:.:.||:|.:|||||...... .|.||.:.|.:|:..|:...|.||.||
Human    61 CDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLA 125

  Fly   127 TPELVKTKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTD 191
            .|.|.|::||::|:||:.|.......:.|..:|.||...|..:||:.:|.|||||.::||.|.|.
Human   126 LPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTP 190

  Fly   192 IHK-------------RGGMDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGI 243
            :.:             |.||             :...|||.|...||.||..|||| :|:|.|||
Human   191 LWEELAALMPDPRATIREGM-------------LAQPLGRMGQPAEVGAAAVFLAS-EANFCTGI 241

  Fly   244 SLPVDGG 250
            .|.|.||
Human   242 ELLVTGG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 92/267 (34%)
fabG 4..251 CDD:235975 92/267 (34%)
HSD17B14NP_057330.2 RDH_SDR_c 1..256 CDD:187638 92/267 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5306
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4508
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.