DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and pecr

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_031749362.1 Gene:pecr / 496922 XenbaseID:XB-GENE-1009809 Length:300 Species:Xenopus tropicalis


Alignment Length:257 Identity:90/257 - (35%)
Similarity:136/257 - (52%) Gaps:16/257 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETA----DNIVAAGGATPLELQAD 64
            |::||.||||..:|||.:.|..|..||..::|..|..|:|||||    ..|..|..|....||.:
 Frog    12 FRNKVAIVTGGGTGIGKAIAAELLGLGCSVIIASRKLERLKETAKELTSRIAPASPALLTPLQCN 76

  Fly    65 MTKEAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPE 129
            :.:|.||:.:|.:||..|||||.||||.|.......||.|.:.::.:::||:...:.........
 Frog    77 IRREEEVETLVKSTLGLHGRIDFLVNNGGGQFPSPSEAISAKGWNAVIDTNLTGTFYCCKAVYNA 141

  Fly   130 LVKTKGN-IVNVSSVCGL-RAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIV--T 190
            .:|..|. |||:  |..: :.|||:.....::||||..|..:|:|.|..|||:|:|.||.|.  |
 Frog   142 WMKEHGGAIVNI--VADMWKGFPGMAHTGAARAAVDNLTKSLAIEWAHSGVRINSVAPGTIFSQT 204

  Fly   191 DIHKRGGMDEETYAKFLEHCKI-THALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGGR 251
            .:.....|..:.:..::.  || ...||.|   :||:..:.||.|..:||.:|.::.:|.|:
 Frog   205 AVENYKDMGPQLFQSYIP--KIPAKRLGLP---EEVSPTVCFLLSPASSFISGETIKIDAGQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 90/257 (35%)
fabG 4..251 CDD:235975 89/255 (35%)
pecrXP_031749362.1 TER_DECR_SDR_a 28..263 CDD:187627 80/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.