DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and cbr4

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001007873.1 Gene:cbr4 / 493259 XenbaseID:XB-GENE-5935857 Length:236 Species:Xenopus tropicalis


Alignment Length:245 Identity:80/245 - (32%)
Similarity:122/245 - (49%) Gaps:17/245 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTKEAEV 71
            ||..|.|.|.|||.:.:..||:....:.::.|:.|..|..|..:.|     .|.|..|::||.|:
 Frog     3 KVCAVFGGSRGIGKAVSKLLAQRDYKVAVISRDLEVAKAAAAEVGA-----HLALSCDVSKENEI 62

  Fly    72 QQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVKTKGN 136
            |..........|.:|.|||:|||.....:..|..|....|::.|:....|...||...:::.:|.
 Frog    63 QDTFKEITNNLGNVDYLVNSAGIRRDALLLRTRSEDIRSLLSVNLVGTIQTCKLALRSMIQQQGG 127

  Fly   137 -IVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHKRGGMDE 200
             |||:.|:.|.:...|...|..||..:..|:..:|.|:|.:.:|||.|.||.|.||:..  |::|
 Frog   128 AIVNIGSIVGHKGNIGQSIYGASKEGLIGFSKSLAKEVAKRNIRVNVVAPGFIHTDMTL--GLEE 190

  Fly   201 ETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGG 250
            ::..|.:       .|||.||.:|||.::.||.  ::.:.||..|.||||
 Frog   191 DSLTKMV-------PLGRFGDPEEVAQSVLFLL--ESPYITGHVLVVDGG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 80/245 (33%)
fabG 4..251 CDD:235975 80/245 (33%)
cbr4NP_001007873.1 NADB_Rossmann 3..232 CDD:389744 80/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.