DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and MGC79752

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001005019.1 Gene:MGC79752 / 448527 XenbaseID:XB-GENE-5820599 Length:264 Species:Xenopus tropicalis


Alignment Length:255 Identity:161/255 - (63%)
Similarity:197/255 - (77%) Gaps:0/255 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTK 67
            :.||||.:||||||||||..|:..|:||..|.:.|||||||:|||.......|..||.:..|:|.
 Frog    10 NLKDKVCLVTGASSGIGAGTALLFARLGARLALNGRNEEKLQETAQGCEQFSGMKPLLVPGDLTD 74

  Fly    68 EAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVK 132
            |..|::||..|:|..||:|||||:.|||..|::|.|||:.|||:||.|||||:.||.||.|.|::
 Frog    75 EESVRKIVEQTVAHFGRLDVLVNSGGILAMGTVENTSLQDFDRVMNVNVRSLFYLTHLAVPHLIQ 139

  Fly   133 TKGNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHKRGG 197
            |||||||||||.|.|:|||||||.:||:||||.|.|.|||||||.||||||.||||:||:|:|.|
 Frog   140 TKGNIVNVSSVNGQRSFPGVLAYCMSKSAVDQLTRCAALELAPKQVRVNAVCPGVIITDVHRRAG 204

  Fly   198 MDEETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGGRHAMCPR 257
            ::||.|::|::..:.||||||||.|.|||..|||||||.|||.||:::||||||||||||
 Frog   205 LNEEQYSEFIQRTQHTHALGRPGTVDEVAKTIAFLASDAASFITGVTMPVDGGRHAMCPR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 156/249 (63%)
fabG 4..251 CDD:235975 153/246 (62%)
MGC79752NP_001005019.1 SDR_c11 11..261 CDD:187622 156/249 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 300 1.000 Domainoid score I1409
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133865
Inparanoid 1 1.050 324 1.000 Inparanoid score I2455
OMA 1 1.010 - - QHG45843
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm48147
Panther 1 1.100 - - O PTHR43975
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.170

Return to query results.
Submit another query.