DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and F12E12.11

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001040762.2 Gene:F12E12.11 / 4363044 WormBaseID:WBGene00044811 Length:280 Species:Caenorhabditis elegans


Alignment Length:262 Identity:101/262 - (38%)
Similarity:142/262 - (54%) Gaps:13/262 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAG--GATPLELQA 63
            |:.|..||.:|||:|:|||.:||:..|:.|..:.|.|||.|:|:||...|:.:|  ....|.:.|
 Worm     1 MARFSGKVALVTGSSNGIGRAAALLFAQQGAKVTITGRNAERLEETRQAILKSGVPAENVLAIAA 65

  Fly    64 DMTKEAEVQQIVGATLAKHGRIDVLVNNAGILETG-----SIEATSLEQFDRLMNTNVRSLYQLT 123
            |:..:.....::..||.|.||:|:||||||.....     .|: ..:|.||:....|:||:..|.
 Worm    66 DLATDQGQTDLINGTLQKFGRLDILVNNAGAAVNDPQGRMGID-QQIEDFDKTFQINMRSVVTLV 129

  Fly   124 MLATPELVKTKGNIVNVSSV-CGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGV 187
            ..|...|:||||.|:||||: .|..|.|.::.|.:||||:||||...|:.|...|||||:|:||.
 Worm   130 QKAKEHLIKTKGEIINVSSIGGGPHAQPDMMYYGMSKAALDQFTRSTAITLIQHGVRVNSVSPGG 194

  Fly   188 IVTDIHKRGGMDE---ETYAKFLEHCKITHALGRPGDVKEVAAAIAFLAS-DQASFTTGISLPVD 248
            :.|...:..|...   |...|:.|..|.....|......|:|..|||||. ..:|:..|.|:..|
 Worm   195 VYTGFGEAMGFPPGALEKIMKYFESHKECVPCGHMAQPIEIAQVIAFLADRTMSSYIIGQSIIAD 259

  Fly   249 GG 250
            ||
 Worm   260 GG 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 100/259 (39%)
fabG 4..251 CDD:235975 100/259 (39%)
F12E12.11NP_001040762.2 fabG 3..261 CDD:235975 98/258 (38%)
NADB_Rossmann 4..265 CDD:304358 100/259 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45843
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.