DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and CG3301

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster


Alignment Length:240 Identity:66/240 - (27%)
Similarity:115/240 - (47%) Gaps:38/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADM 65
            |:.:.::|.:|||||:||||:....|...|.::|.:.|.|:.|::...::.|...|.......|:
  Fly     1 MNRWLNRVAVVTGASAGIGAACCRDLVAKGMVVVGLARREKVLQDIKSSLPADQAARFHTRPCDV 65

  Fly    66 TKEAEVQQIVGA------TLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTM 124
            :.|   ||::..      ||   |..|||||||||:...:|.       |...:.:||::..:.:
  Fly    66 SNE---QQVIDTFAWIDRTL---GGADVLVNNAGIIRQMNIT-------DPENSADVRAILDVNV 117

  Fly   125 LATP--------ELVKTK---GNIVNVSSVCGLRAFPGVLAYNV-----SKAAVDQFTACIALEL 173
            |...        .|.:.|   |::|.::||.| .:.|.|..:::     ||.|:...|..:..|.
  Fly   118 LGVTWCTRQWFLSLQRRKVNDGHVVVINSVVG-HSVPAVEGFSLNMYAPSKHAITALTEILRQEF 181

  Fly   174 APKG--VRVNAVNPGVIVTDIHKRGGMDEETYAKFLEHCKITHAL 216
            ..||  .::.:::|||:.|:|.:.|..::.|....|....|..|:
  Fly   182 IKKGTQTKITSISPGVVATEIFEAGSWEQPTGMPMLRSEDIADAV 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 65/237 (27%)
fabG 4..251 CDD:235975 65/237 (27%)
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 66/240 (28%)
NADB_Rossmann 1..245 CDD:304358 66/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435099
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.