DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31549 and dhrs4

DIOPT Version :9

Sequence 1:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_956861.2 Gene:dhrs4 / 393539 ZFINID:ZDB-GENE-040426-1498 Length:276 Species:Danio rerio


Alignment Length:249 Identity:80/249 - (32%)
Similarity:140/249 - (56%) Gaps:7/249 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTKEAEV 71
            ||.|||.::.|||.:||..|.:.|..:|:..|.:..: :.|.:::.:.....:....::.|..:.
Zfish    31 KVAIVTASTDGIGLAAAEALGQRGAHVVVSSRRQTNV-DKAVSLLRSKNIKVIGTTCNVGKAEDR 94

  Fly    72 QQIVGATLAKHGRIDVLVNNAGILE-TGSIEATSLEQFDRLMNTNVRSLYQLTMLATPELVKT-K 134
            ::::..|:.:.|.:|:||:||.:.. .|:|..::.|.:|:::..||::.:.||.:..|.:.|. .
Zfish    95 EKLINMTVEQCGGVDILVSNAAVNPFFGNILDSTEEVWDKILGVNVKASFLLTKMVVPHIEKRGG 159

  Fly   135 GNIVNVSSVCGLRAFPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVTDIHKRGGMD 199
            |::|.||||.|.:..|.:..|:|||.|:...|..:|.|||...:|||.|.||:|.|........:
Zfish   160 GSVVIVSSVAGYQPMPALGPYSVSKTALLGLTRALAPELAQSNIRVNCVAPGIIKTRFSSALWEN 224

  Fly   200 EETYAKFLEHCKITHALGRPGDVKEVAAAIAFLASDQASFTTGISLPVDGGRHA 253
            |....:||:...|.. ||:|   :|:...||||.||:||:.||.::.|.||.::
Zfish   225 EGVLEEFLKQTSIKR-LGQP---EEIGGVIAFLCSDEASYITGETITVTGGMNS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 80/249 (32%)
fabG 4..251 CDD:235975 79/245 (32%)
dhrs4NP_956861.2 CR_SDR_c 21..276 CDD:187641 80/249 (32%)
fabG 28..272 CDD:235975 79/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.